Sentencedict.com
 Directly to word page Vague search(google)
Home > Comprise in a sentence

Comprise in a sentence

  up(8)  down(13)
Sentence count:155+1Posted:2016-07-21Updated:2020-07-24
Synonym: consist ofcontainincludeinvolveSimilar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensibleMeaning: [kəm'praɪz]  v. 1. be composed of 2. include or contain; have as a component 3. form or compose. 
Random good picture Not show
(31) Single rupee sachets comprise about 70 per cent of the company's shampoo sales.
(32) Gifts could comprise not only land, but also money and precious objects, including jewellery.
(33) Patients with left ventricular ejection fraction greater than 30% and no inducible ventricular arrhythmia comprise a heterogeneous group.
(34) Living beings comprise a whole sequence of levels forming such a hierarchy.
(35) A concurrent trade fair will comprise stands of about fifty museums, exhibition specialists and suppliers.
(36) Such anxieties are still informed by nineteenth-century pseudo-scientific genetic and biological explanations of racial difference and comprise distortion, fantasy and myth.
(37) Many surgical waiting lists comprise large numbers of simple, low cost, procedures.
(38) Strictly speaking, in what ontological category of things are causes and other conditions, the things which comprise causal circumstances?
(39) Above the collection of stone-built houses that comprise Cotterdale, the fields were giddy with colour.
(40) But, as Taylor shows, in the value-adding spectrum, they only comprise the first stage of a four-stage process.
(41) People over sixty-five will comprise at least 20 percent of the population, up from 5 percent in 1900.
(42) They comprise pits dug deep into the ground, lined with logs, and covered with a low cairn of stones.
(43) However, the structure of attitudes does not only comprise the explicit justifications and criticisms which might be advanced by the attitude-holder.
(44) These workers, full-time and part-time, and their family members, comprise an additional 30 million people living in poverty.
(45) They comprise pledges on national standards and a new set of promises specifically geared to the local area.
(46) The acts they comprise are invested with special meaning and are pointed toward perfection.
(47) Indeed, one may even say that sexuality was the theme linking the various items which comprise the matrix that is Orphism.
(48) The port also has plans for Pier 70 where 40 to 50 small buildings could comprise a historical district.
(49) The second question concerns the types of groups most likely to comprise the largest support for violent rebellions or revolutionary movements.
(50) The interview should comprise of open-ended questions to support and encourage the child in free recall. 5.
(50) Sentencedict.com is a sentence dictionary, on which you can find excellent sentences for a large number of words.
(51) The well-drained areas on the mounds comprise brown forest soils and humus-iron podzols.
(52) Additional components comprise an extra electro-hydraulic control valve to actuate fourth-to-fifth and fifth-to-fourth shifts and the extra gear set itself.
(53) For the Out Skerries comprise a group of three little islands which are conveniently arranged to form a perfect natural harbour.
(54) Medicare, Medicaid and other entitlement programs that comprise two-thirds of the federal budget.
(55) They comprise three main categories: coronary artery disease, cerebrovascular disease, and venous thrombosis.
(56) They will comprise 75 percent of the state's public school population.
(57) Therefore net cash balances comprise cash and cash equivalents together with money market deposits.
(58) In more complicated cases or where a larger aircraft is concerned the investigating team can comprise up to a dozen investigators.
(59) Unlike a company, a partnership possesses no legal personality separate from the partners that comprise it.
(60) Class-A antelopes are small and good at selecting plant parts to comprise a good diet.
More similar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensiblesurprisingcomparisonsurprisinglyby comparisonin comparison withimpressimprovedimpressiveimpressionraiseadvisecruiseadviserpremiseprecisefranchiselikewiseexpertiseprimepriceprizeprint
Total 155, 30 Per page  2/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words