Sentencedict.com
 Directly to word page Vague search(google)
Home > Decision-making in a sentence

Decision-making in a sentence

  up(1)  down(2)
Sentence count:259+3Posted:2017-05-14Updated:2020-07-24
Similar words: decision makingdecisionprecisiondecisivedecisivelyindecisiveindecisivelydecisiveness
Random good picture Not show
211. In an attempt to provide operational decision-making reference program of shanxi Province high-skilled personnel development.
212. Pass example imitate decision-making test and verify, value of actual and optimal quote all is in computative limits extraction a cost, and corresponding probability is higher.
213. The country's first free with their own intellectual property rights of innovative shares decision-making system.
214. More decision-making the part with downstage operation, it is Cao Guowei and Wang Yan are being acted.
214. Wish you can benefit from our online sentence dictionary and make progress every day!
215. The success of Finance customer management system have forcefully driven the administrative informatization of Chinese postal service and provides the data for the managerial decision-making.
216. In techno-economic analysis about the many kinds of equipment renewal modes, it is a controversial issue on how to handle the old equipment's cash realizable value in the renewal decision-making.
217. Logistics enterprises from various sources often reduce the cost of business operations, including distribution centers address selection is one of important decision-making.
218. Then the solution of the highest and lowest efficiency score of each decision-making unit (DMU) was discussed. So we can gain an interval efficiency score of each DMU and classify the DMUs.
219. To emphasize professional and innovative decision-making skills through multidisciplinary approaches across departmental boundaries.
220. Studies Department, the French government and parliament have their own decision-making on major technology assessment of the technology assessment bodies.
221. It's all happening here in you limbic brain, the part of the brain that controls decision-making and not language.
222. In section 4, trying to establish a risks early warning system in trust investment fund, offers means of risk management in order to help decision-making to improve ability of risks control.
223. Family decision-making is thought to be the exclusive domain of men, who enjoy by default the legal status of "head of household."
224. The reform of giant department is supposed to establish the reasonable division of decision-making power, law enforcement power, and supervision power.
225. In societies where corruption is endemic, decision-making is slowed as more politicians and officials have to be paid off.
226. In the practice of decision-making, typical approaches of citizen participation include public hearing[sentencedict.com], consultative committee and so on.
227. Based on analysis, a novel bid risk decision-making model is built.
228. Course-timetabling problem, an optimization decision-making problem involving factors such as classes, teachers and classrooms etc, is a typical problem of combinatorial planning.
229. Conclusion Echocardiogram by thoraces possess important clinic value in diagnosis, orientation, therapeutic decision-making, estimating prognosis of infective endocarditis valve excrescence.
230. Then, test the uncertainty decision-making difference between existence of the principal-agent and inexistence of the principal-agent by designing the decision-making questionnaire.
231. Timing and flow control are key problems in strategic decision-making simulation system.
232. In the investigation study, the results suggested that the external representation has the remarkable difference in decision-making behavior.
233. This article makes research about decision-making on cost of receivable account funds and stock, and discuss about howto reduce operation cost, dodge the risk and enhance benefit.
234. Now, the prediction model is applied in the assistant decision-making system for a copper converter.
235. The prospective couple there had no decision-making authority, indeed no input at all in the negotiations that could eventuate in their marital union.
236. Later in the day, all 12 experts met with the North Atlantic Council, NATO's highest decision-making body.
237. Bartlett, Beatrice S. "The Vermilion Brush: The Grand Council Communications System and Central Government Decision-Making in Mid-Ch'ing China", Ph. D. Dissertation, Yale University, 1980.
238. With that basis, we propose a centralized inventory decision-making mechanism based on risk pooling.
239. This paper improved the priority method used in collective policy decision-making, making it more applicable to solve conflict analysis problem.
240. What is the history and context of the decision-making process?
More similar words: decision makingdecisionprecisiondecisivedecisivelyindecisiveindecisivelydecisivenesspolicy makingpolicy-makingexcisiondisillusionmentprovisioningquestion markproduction managerwakingtakingshakingspeakingsqueakingbreakingovertakingpainstakingundertakingvisionbackbreakingbreathtakingdecimationdecipheringelision
Total 259, 30 Per page  8/9  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words