Sentencedict.com
 Directly to word page Vague search(google)
Home > Drastic in a sentence

Drastic in a sentence

  up(0)  down(4)
Sentence count:199+9Posted:2017-02-16Updated:2020-07-24
Synonym: extremefierceintenseroughseveretoughviolentSimilar words: drasticallyprocrastinateplasticprocrastinationbombasticfantasticgymnasticsenthusiasticMeaning: ['dræstɪk]  adj. forceful and extreme and rigorous. 
Random good picture Not show
31. Nothing drastic or even very specific was proposed.
32. The rising incidence of drunken driving requires drastic countermeasures.
33. The protein eats normal cells, leading to the drastic weight loss which weakens patients and prevents them fighting the disease.
34. The vaccine brought a drastic drop-80 percent-in paralytic polio cases by 1957.
35. We need better computer models and more reliable climate data before we take any drastic countermeasures. 3.
36. Britain in mid-1979 was unlikely to lurch into any drastic transformation, let alone a dictatorship.
37. He was able to sit up, his back injuries seemed to be less drastic than they had first appeared.
38. A: Oh, we don't have to be quite so drastic.
39. But now even bigger and more drastic changes are on the horizon.
40. However, other less drastic methods of resolving disagreements are available.
41. Of all physician weight-loss treatments(sentencedict.com), surgery is the most drastic.
42. But performances have been consistently below par for too long and drastic action needs to be taken.
43. Assume the most drastic situation, complete closure of the entire euro-dollar market.
44. The ground was frozen, and digging foundations was practically impossible in such drastic weather conditions.
45. Drastic changes, up or down, hamper longer-term development and can mean re-drafting the national budget at short notice.
46. Nothing drastic - it's just that his studio is taking on a more Tardis-like appearance than before.
47. The result in each case had been the conversion of my patient into pork pies and a drastic plummeting of my self-esteem.
48. Yeltsin took drastic steps to move his country toward a market economy, steps that required severe sacrifice for millions of people.
49. California in 1990 enacted a plan requiring drastic cuts in air pollution from automobiles.
50. A conflict between two fellow-workers may not require such a drastic step.
51. This is after the economic miracle, drastic military government,(sentencedict.com/drastic.html) unserviceable debt.
52. Why did I think it necessary to take such drastic measures?
53. Start your kitchen reorganization with a drastic sort-out and throw-out.
54. California law protects him from having to take such drastic measures, however.
55. Competition has forced drastic improvements in some areas, such as express mail.
56. The situation is drastic, but I suspect that we will not hear special pleading for Bass workers from Conservative Members.
57. Methods for dissociating cells are therefore more drastic and not necessarily compatible with long-term viability.
58. With prolonged heavy drinking, the effects of alcohol on health can be drastic.
59. When reception class children fight back, schools take drastic measures to avoid clashes.
60. Beginning last spring, art museums have been reeling from drastic cuts in government support.
More similar words: drasticallyprocrastinateplasticprocrastinationbombasticfantasticgymnasticsenthusiasticecclesiasticalenthusiasticallycontrastby contrastcontrast todramaticdramaticallyinfrastructuremelodramaticswastikachastisepastimemastiffboastingstickcastigatestickyrusticmysticeristicstick tostick out
Total 199, 30 Per page  2/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words