Sentencedict.com
 Directly to word page Vague search(google)
Home > Extensively in a sentence

Extensively in a sentence

  up(1)  down(4)
Sentence count:213+10Posted:2017-07-05Updated:2020-07-24
Similar words: extensiveintensivelypensivelydefensivelycomprehensivelyapprehensivelyextensionintensiveMeaning: adv. in a widespread way. 
Random good picture Not show
121. The trilobites evolved rapidly, and can therefore be used extensively in the dating of rocks at this time.
122. Latterly, he has written extensively about alternative medicine.
123. Stalkup has extensively reviewed the status of miscible displacement.
124. Such contamination has been extensively studied.
125. Multiple linear regression is used extensively in prediction.
126. Almonds are used extensively in confectionery.
127. Thirdly, extensively implement industrial restructuring and revive project.
128. At present safe printing ink applies extensively already at commodity prevent bogus.
129. As one of important qualitative evaluations, performance assessment has been extensively in attention.
130. Now ASF is applied to investigate ASGP receptor of liver extensively.
131. Clay minerals distribute extensively in various slopes made of sedimentary rock, weathering profiles of igneous rock, metamorphic rock and sedimentary rock and colluvial deposits.
132. T 2 rotary awl cover is a kind of structural member that has been applied extensively.
133. It is extensively used in the area of interactive Computer graphics system, maltilinguistic compute integrated publishing system and cartoon.
134. To achieve the aforementioned goals, information technology will be extensively applied.
135. Apply engineering machinery, colliery machinery, petroleum industry, traffic, input water, trade of welding etc. extensively.
136. A programming language designed for list processing and used extensively for artificial intelligence problems.
137. When humans switched to meat-eating, they triggered a genetic change that enabled better processing of fats, said Stanford, who has worked extensively with gerontologist Caleb Finch of USC.
138. Haeckel used embryology extensively in his recapitulation theory, which embodied a progressive, almost linear model of evolution.
139. The model is required to satisfy the IRB approach, to effectively identify and measure the credit risk and to extensively cover a full range of quantitative and qualitative factors.
140. Light scattering matrix of random oriented two spheres system is studied extensively by using the T matrix method and the principle of superposition.
141. The worldwide extensively application of financial failure prediction model is still in the stage of exploration.
142. "The finding of fellatio in bats is exciting news," says Frans de Waal(sentencedict.com), a primatologist at Emory University in Atlanta who has worked extensively with bonobos.
143. Well, being in the agriculture business calcium sulfate I know is gypsum, and we use it as a soil amendment in California quite extensively.
144. The seed irradiator designed and built is very efficient and effective and has already been used extensively in radiobiological experiments and the accuracy of dosimetry.
145. It is important to tap the market potential extensively around the world.
146. Phosphatidylinositol 4, 5 - bisphosphate ( PIP _ 2 ) is extensively distributed in the interior side of the eukaryotic cell membrane.
147. So it is used extensively in hydraulic engineering of our country too.
148. Controlling and reducing automobile pollution is a complexly technological and extensively social issue.
149. CONCLUSIONS: Markov model should be applied in drug market extensively.
150. Therefore, it can be extensively applied in petroleum metallurgy, drilling crew and research institutions[sentencedict.com], etc.
More similar words: extensiveintensivelypensivelydefensivelycomprehensivelyapprehensivelyextensionintensiveexpansivelysensitivelyintensive cultivationpensiveoffensiveexpensivedefensivepassivelymassivelyevasivelyderisivelyabrasivelydecisivelyinexpensivecompulsivelyobsessivelyimpulsivelysubmissivelyexclusivelyimpassivelyexcessivelypersuasively
Total 213, 30 Per page  5/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words