Sentencedict.com
 Directly to word page Vague search(google)
Home > Gasket in a sentence

Gasket in a sentence

  up(0)  down(0)
Sentence count:103Posted:2017-10-30Updated:2020-07-24
Similar words: sketchbasketcasketmusketsketchymusketrysketch outdisketteMeaning: ['gæskɪt]  n. seal consisting of a ring for packing pistons or sealing a pipe joint. 
Random good picture Not show
(61) The engine had blown a gasket, ie the gasket had suddenly let steam, etc escape.
(62) I. Features: PTFE gasket is manufactured by molding method with PTFE granular resin.
(63) It still has some difficulties to substitute non-asbestos gasket for asbestos gasket because of the reasons from usages, requirements in cons...
(64) An engine cylinder head gasket leaking between a cylinder and an adjacent water jacket is indicated by coolant foaming or overheating and loss of coolant.
(64) Wish you can benefit from our online sentence dictionary and make progress day by day!
(65) Place Whatman paper on gel dryer, turn on heat and suction, and cover with sealing gasket.
(66) The paper introduces the fault phenomena of cylinder gasket destroyed in diesel engine in application, analyzes and researches the reasons and mechanism which cause the fault.
(67) Moto parts major in Iveco fitting , C . V boot , flasher , Distributor cap, Gasket and so on.
(68) By analyzing for the flange leakage on a heavy oil catalytic pyrolysis unit, the writer put forward a treatment method, i. e. to replace old asbestos gasket with a compound corrugated gasket.
(69) Any material deviations from standard - packing , gasket, bolting, etc.
(70) The results expatiated that the strength of such cylinder head gasket meet the need when being used.
(71) Regular testing of gasket resiliency and inspection at Receiving due to sensitivity to inconsistent quality.
(72) The oil - pan gasket fits between the oil pan and bottom pf the engine block.
(73) Remove the bezel and rubber gasket from the motor output shaft.
(74) The preparing method of fluoroelastomer ( FKM ) coat - metals Gasket that used for the seal internal - combustion engine cylinder was introduced.
(75) The male and female joint confines the gasket O . D and I. D.
(76) Made by Nike . Suitable for all ages. Shatter resistant neoprene gasket . Single silicone strap.
(77) Hydraulic lifting gear, very smooth; gasket under the sun wheel position adjustment,(Sentencedict.com) the effective use of the gear and sun gear.
(78) The mechanical and sealing behavior of the strengthened gasket were studied and compared with the stainless steel graphit spiral-wound gasket and the stainless steel packing asbestos gasket.
(79) This connection has a left - hand thread ( loosens with clockwise rotation ) and requires a gasket to seal.
(80) Forbid welding the flange after installing the valve. Both sides of the flange should be added the asbestos gasket.
(81) The acquirement of accurate 3D measurements of the engine cylinder gasket is the key of quality control and reverse engineering.
(82) The silicon and fluorine rubber with high temperature resistance, low compression permanent deformation, and high tear strength properties can meet the water sealing gasket requirements.
(83) The pressure distribution is determined by measuring the pressure at various points between the diamond cullet faces and the thin metal gasket using the ruby fluorescence method.
(84) Cylinder gasket, metal gasket , rubber, sealants and other dozens of products, Shang Wange different specifications.
(85) Spacer ring provides bearing surface and prevents deformation of the gasket.
(86) In the direction of the existence of the outer ring gasket with high residual compression stress of the closed ring, the close of their joints have a crucial role.
(87) In our group, we have many professional manufacturer for Ball joint, Tie rod, Brake pad , Gasket, Rubber parts, Filter , Belt tightener , Bearing, Clutch disc and so on.
(88) Can also be used when necessary, such as PTFE gasket materials.
(89) Conductive gasket material is one of the most widely used shielding materials at present, and plays an important role on the suppression of electromagnetic slot -leakage in electronic equipment.
(90) Self - locking include self - locking teeth external blade, silicon rubber gasket, internal ring.
More similar words: sketchbasketcasketmusketsketchymusketrysketch outdiskettesketchpadbasketballsketchilysketch mapsketchingsketchbookwaste basketwastebasketmusketeerbreadbasketsewing basketbasketball teambasketball courtshopping basketbasketball playerskewaskewgasmaskedskeingashgasp
Total 103, 30 Per page  3/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words