Sentencedict.com
 Directly to word page Vague search(google)
Home > Stacking in a sentence

Stacking in a sentence

  up(0)  down(0)
Sentence count:80Posted:2017-06-07Updated:2020-07-24
Similar words: attackinglackingcrackingblackingtrackinghijackingransackingsend packing
Random good picture Not show
31, Be responsible for the total management, maintenance, stacking and work safety of the tailing dam.
32, They can be classified into wafer level, chip level, and package level stacking.
33, The effect of stacking parameters and fiber surface treatment on the longitudinal tensile properties of F-12/CF hybrid epoxy composites had been studied.
34, In composite system filled with solid and solid liquid phase, rational particle grade improve particles arrangement closer and increase stacking density.
35, Microdomain building theory made great progress in explaining the formation of carbonaceous mesophase, but the introduction of the non-existent stacking units of molecules is a defect of the theory.
36, Sample stacking in capillary electrophoresis is one of the effective techniques to concentrate sample species, thus improving the detection sensitivity.
37, With many planets stacking up in Taurus, your opposite sign, you won't have firm control over how things work out, so you will have to either offer a compromise or set up a payment plan.
38, Generally seismic pre - stacking for ward modeling was done by ray tracing or two - way wave equation algorithms.
39, When he gets back to his quarters, he stares in disconcertment at his purchases before shoving things in the refrigerator and stacking them in cabinets.
40, This paper employed CE - ECL with field - amplified stacking technique to detect bupivacaine in rat plasma.
41, The parsimonious processing includes deconvolution, constant phase filtering, pure phase filtering, frequency spectrum extrapolation[Sentencedict.com], stacking and so on.
42, The result of this stacking of ions is a cubical crystal of common table salt.
43, This paper introduces a number of bare and multichip module stacking technologies that are emerging to meet the ever increasing demands for low power consumption, low weight and compact systems.
44, Convergent-beam electron diffraction zone-axis patterns have been obtained from transverse basal stacking faults in graphite and molybdenite.
45, The Kuangshanliang and Tianjingshan present a duplex which comprises of a shallow fault-bend fold of late Triassic and a deep blind stacking anticline imbricated by several thrust sheets of Cenozoic.
46, He dug up big lumps of dirt and placed them overtop of each hearth that was made by stacking bricks together.
47, The image of seismic discontinuous points is analogous to CMP stacking technique in reflection wave exploration.
48, Successive bunches of antiprotons from the Antiproton Decelerator can be added to the trap,(http://Sentencedict.com) a process invented by TRAP called stacking.
49, Pallet stacking forklift with rotatable forks. Working aisle clearance area can be shown.
50, This paper deals with two problems, nonzero -offset Fresnel zone in homogeneous media, and the effect of velocity error resulted in NMO correction and stacking on vertical resolution.
51, The stacking sequence of composite laminate was calculated at given in - plane geometry and bend factors.
52, The crosswell seismic data processing mainly consists of two aspects: one is crosswell tomography imaging processing, and another is crosswell back wave stacking imaging processing.
53, Court barbola is a multi-layered pattern that is composed of materials like silk, cotton, and phoenix-tail yarn, and goes through a process of separation, combination, affixing , and stacking.
54, Interface to a window object, controlling appearance and focus, positioning and stacking, event buffers and surface access.
55, Let's be clear: Memorizing 23,000 words takes a long time, which is one reason why a pure stacking mechanism can be greatly improved upon when you're dealing with numbers that big.
56, You combine your shooting method with the this kind of stacking to enrich your expression.
57, It was found that there exist prismatic dislocations, stacking faults , array of dislocations and dislocation network.
58, The processing of theoretical model and real data shows that the time_shifted normal moveout and stacking may produce a high_fidelity, high_resolution and accurate stacking image effect.
59, A stacking system based on moving reaction boundary(MRB) for stacking and quantitative determination of oxymatrine(OMT) in urine samples was developed.
60, All closed -packed arrangements are built by stacking of close-packed layers of the type.
More similar words: attackinglackingcrackingblackingtrackinghijackingransackingsend packingnerve-rackingnerve-wrackingstackstackedkickingfuckingmockinglickinglockingpickingprickingknockingstockingstickingshockingcheckingmockinglyshockinglysticking outrollickingpolitickinginterlocking
Total 80, 30 Per page  2/3  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words