Sentencedict.com
 Directly to word page Vague search(google)
Home > Transition in a sentence

Transition in a sentence

  up(11)  down(5)
Sentence count:198+11Posted:2016-07-16Updated:2020-07-24
Synonym: changeconversiontransfertransformationSimilar words: transittransactiontranslationtransformationtransportationtransientpositiontransmissionMeaning: [træn'sɪʃn ,-z-]  n. 1. the act of passing from one state or place to the next 2. an event that results in a transformation 3. a change from one place or state or subject or stage to another 4. a musical passage moving from one key to another 5. a passage that connects a topic to one that follows. v. 1. cause to convert or undergo a transition 2. make or undergo a transition (from one state or system to another). 
Random good picture Not show
151 But the graceful transition between the old and the new reached its climax as a special committee, amid repeated and reverberant cheers, escorted Mr Eisenhower and Mr Nixon to the platform.
152 Current leads are transition components between low-temperature magnets and room-temperature bus-bar .
153 In China, broadcast television is in the transition from the traditional analog system to the new system based on digital, network and interactive technologies.
154 Each event is in the domain of the transition function belonging to the "current" node, where the function's range is a subset of the nodes.
155 The dispatcher manages the transition from ready to - run to run.
156 In some problems in quantum transition, time-dependent perturbation theory gives the first order approximation of transition probability amplitude.
157 Additional features include: programmable transition delay, low quiescent current, higher efficiency at light loads,(Sentence dictionary) and high speed control to quickly turn off both gate drivers.
158 Some think the politburo member hopes the high-profile campaign will help to elevate him in the runup to 2012, when the transition of power to China's next generation of leaders is due to take place.
159 Later, scholars did sophisticated researches on SVAR, and used them to anglicize real shock and monetary shock's transition mechanism.
160 Manchester encoding avoids both these problems by having a transition between high and low in the middle of each bit.
161 Intelligent Transportation Systems ( ITS ) represent a major transition in transportation on many dimensions.
162 Glyphosate, as a transition state inhibitor of EPSP synthase, inhibit the canalization of the enzyme as an EPSP synthase·EPSP·glyphosate ternary complex.
163 Transition 2 The parser calls characters() for every character data in the document, including indenting.
164 The electromagnetic transition process and stability analysis are studied also . Then the transient performance is studied.
165 On the other hand,(sentencedict.com) phase transition and critical phenomena are emphases in statistical physics.
166 When a nuclear physicist try to increase energy of electron, the electron immediately pleased transition immediately from low energy level to high level.
167 Objective To stop permanent anterior crossbite in early period of dental transition.
168 In Yunnan, I have witnessed three villages make the transition from " roadless " to "connected".
169 A better agreement is found in the geometry between semiempirical and ab initio transition states, and a greater deviation in the activation energy, in which.
170 The miscibility of CS blends in formic acid was characterized by solubility parameter, dilute solution viscometry, refractive index and glass transition temperature, FT-IR etc.
171 With this transition, English teaching gradually becomes practical and actually plays the foundation for each student's life-time development.
172 An improved optimal control algorithm is derivedis realized by using the numerical method of state transition.
173 Simulation in the deterministic model elucidated a rhythm transition process governed by a period adding bifurcation scenario.
174 Standard Chartered has become an international pioneer in leading the transition to low carbon: one of the first major banks to apply climate criteria to all its project lending.
175 As a matter of fact, the annealing temperature and time influence the transition of the semicond-uctive as-grown fiber to superconductor which is a peritectoid reaction.
176 Cost of resource city transition can be divided for ordering cost and cost of incur loss through delay .
177 Bioenergetics of fish is a subject studying energy transition in fish.
178 Objective To discuss the logical relation in concept transition of syndrome manifestations in different syndrome types.
179 As BPD will become a controlling shareholder of the Company, the Board of Directors also sought immediate approval of the Change of Control so the transition may proceed smoothly.
180 However, it is also a fundamental step in the transition of tumors from a dormant state to a malignant one.
More similar words: transittransactiontranslationtransformationtransportationtransientpositiontransmissionoppositioncompositionacquisitiontraditiontraditionaltraditionallysensitivetransformtransfertransmitsensitivitytransporttranslatemansionexpansionactive transportsituationeditionadditionconditionmunitionscoalition
Total 198, 30 Per page  6/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words