Sentencedict.com
 Directly to word page Vague search(google)
Home > Weld in a sentence

Weld in a sentence

  up(0)  down(0)
Sentence count:274+1Posted:2017-07-09Updated:2020-07-24
Synonym: bindcementjoinsolderuniteSimilar words: welderheldgeldveldmeldyieldwieldfieldMeaning: [weld]  n. 1. European mignonette cultivated as a source of yellow dye; naturalized in North America 2. United States abolitionist (1803-1895) 3. a metal joint formed by softening with heat and fusing or hammering together. v. 1. join together by heating 2. unite closely or intimately. 
Random good picture Not show
91. According to the different product structure, butt fusion welding process and lap seam welding process are used to respectively weld left and right half shell of upper body.
92. The qualitative analysis is carried out on the behavior of the partial penetrated weld pool with welding current changing from pulsed peak value to base value during pulsed TIG welding.
93. Manner according to weld steel into Longitudinal and drill pipe.
94. The result shows some cracks appearing on vertical weld connecting web plate of body bolster and draft sill as well as the part between web plate of body bolster and top cover plate.
95. Indicates a weld in a square groove. Lines will elongate when height is increased.
96. Fracture morphologies of TIG welds show that the fatigue fracture occurs from weld defects.
97. This paper describes the device and the fundamental procedures used in the method of fast measuring diffusible hydrogen within weld metal by a gas chromatography.
98. Results showed that high stress concentration around the spot weld edge may be the determinable factor for initializing and propagating of the high cycle fatigue crack.
99. A Welding Procedure Qualification Record (Form No. : FN 09/02-02) is a record of the welding data used to weld a test coupon.
100. It is shown that it is improper to calculate the stress round the weld bead with the value of a for the mother material.
101. An engineering calculation method of spot weld fatigue life prediction is introduced.
102. Appplied to process or weld large - area production, as PVC water bed, drifting raft[sentencedict.com], children swimming pool.
103. The results show that the steel has low weld cold crack sensitivity.
104. Indicates a weld in a flanged edge groove. Lines will elongate when height is increased.
105. It has a low welding spatter and aesthetic formation of weld.
106. By increasing the weld heat input, the distribution of martensite becomes more dispersive and glomerate due to the molten pool stiring(Sentencedict.com), the welding stress and the burning loss of alloy elements.
107. A new detecting method for lack of manual weld is proposed.
108. Weld, heat - affected zone and substrate metal test etc.
109. A beam of light produced a laser can weld metals.
110. There exist three brittle temperature ranges during the course of solidification and cooling process in the weld metal of Low-carbon steel.
111. The cross connection point of the round steel should weld fastness.
112. Overview This order applies to iron magnetic material and weld Magnetic particle inspection.
113. Proper extrusion force is critical to ensure weld strength of the spiral weld tube during hi-frequency butt-welding process.
114. A : Can you spot weld a tube to a sheet metal?
115. The discussion involves such aspects as the cause of strip folding occurring in butt-welding process of spiral weld pipe, negative influence by such failure on pipe quality and preventive actions.
116. The dual-torches all-position automatic welding machine could obviously improve the weld bead deposition rate and the welding speed, and promote the single set of equipment ability greatly.
117. Compared with high-speed steel, the wearing resistance of laser weld layer improves by 42.6%.
118. Now our company has managed to develop the collet chuck and guide bush of carbide with wear-resistant weld in good precision.
119. But remember to maintain your concentration on centering the blade and squeezing the weld.
120. So the heat input should be kept low to weld galvanization steel sheet.
More similar words: welderheldgeldveldmeldyieldwieldfieldeldereldestbeheldfieldsupheldafieldseldomshieldinfieldelderlyfield dayeldritchfeldsparyieldingunwieldyairfieldshieldingforce fieldfield tripcornfieldwindshieldunyielding
Total 274, 30 Per page  4/10  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words