Sentencedict.com
 Directly to word page Vague search(google)
Home > Chic in a sentence

Chic in a sentence

  up(3)  down(2)
Sentence count:119+5Posted:2017-01-17Updated:2020-07-24
Synonym: chichichicnesslast wordmodishnesssmartsmartnessstylishnessswankvoguishSimilar words: chickenpsychicethicwhichethicsvehicleethicalempathicMeaning: [ʃiːk]  n. elegance by virtue of being fashionable. adj. elegant and stylish. 
Random good picture Not show
91 Blending modern boudoir glamour with deco chic, all 18 rooms offer a canal view, four-poster beds, and ceiling mirrors to reflect light from the water outside.
92 Strappy sandals, chic Capri pants, and an off-the-shoulder blouse make your entrance into any social event one to take notice of.
93 Lucy made being a '50 housewife chic, whether she was wearing an apron, clad in costume for one of her hijinks or dressed up for a night with Desi at Club Babalu.
94 Each product combines elegant design with a casual chic look based on the finest of leatherwork.
95 Boutiques sell organic yogurt and chic secondhand furniture next to seedy stores stocked with cut-price liquor and junk food.
96 The Tiffany restaurant evokes the warm atmosphere of a chic brasserie and the menu offers the inventive cuisine of the renowned French Pourcel brothers.
97 Add a flirty blouse and cardigan for a super chic weekend look.
98 Long allied with controversial causes, he gave a fund-raiser for the Black Panthers that inspired the term radical chic.
99 After careful packaging design, a variety of packaging fashionable chic, carrying convenience.
100 Long tie belt threads through double belt loops for a chic look.
101 It's no wonder that geeks now have their own consumer category — geek chic — with merchants gearing products toward them and advertisers courting them.
102 Believe it or not, when I got ready for school this morning I wasn't aiming for leprechaun chic.
103 Metope, ground used identical ceramic tile, main body belongs to baby blue department, the clever application of line of bottle green waist(sentencedict.com), appear chic and easy.
104 The Smart area shop-in -shop offers sharp tailoring, fine knitwear and chic accessories for special occasions.
105 Between graceful elegance and lucid modernity, among concise decoration and line, and betweeen simplism and post-simplis. INMISENCE blazes the slick and chic furniture skin.
106 The magazine's tony mix of intellect and bohemian chic was the perfect home for Gladwell's innate quirkiness. His obsessive theorizing was no longer weird.
107 Frisee became one of the chic staples of 1980 s cookery.
108 Beer bubble is rich. Sugariness is chic, a variety of cent of embedded and rich protein, candy,[sentencedict.com] vitamins and amino acid.
109 The Oriental sentiment that glass of printing of a few chic lamps and lanterns, paper -cut and colour glair bottle can show Chinese pattern most.
110 STUDIO's adjustable stroller straps attach neatly and conveniently to the handlebars of any stroller. Unclip, and STUDIO converts back into a tote that will look chic well past babyhood.
111 The firm's modest space, a step up from the garage where Erskine first hashed out the idea, seems more dot-com shabby than financial-services chic.
112 Enjoy chic, contemporary comfort, capturing the casual sophistication of an oceanfront home.
113 The gap has long been celebrated in many African cultures as a sign of beauty. But in Europe and North America, gapped teeth weren't always considered chic.
114 Fan Dance style chic, plate dance moves large extent, rhythm changing, very bright.
115 Jacobs sent out models clothed in eye-delighting tones like turquoise, azure, yellow, hot pink, and royal purple, often in the same outfit in chic combinations.
116 New fund eardrop designs chic, originality infinite, these are modern distinctive small east east let you fondle admiringly for certain.
117 Vintage would also work, especially if you wear a hippie - chic dress by ZandraRhodes or Ossie Clark.
118 Her clothes told me nothing: they were about as nondescript and lacking in chic as it was possible to be.
119 Besides, the hotel also chic appearance year-round sunny sunshine and Arab myth type of luxury, lie on the bed can enjoy half is sea water, half of the desert Arabian gulf beauty.
More similar words: chickenpsychicethicwhichethicsvehicleethicalempathicdemographicchipchinanthropomorphiccatastrophicallychidechillchinachildchilledChineseachievepoachingchitosanbe rich infranchisechildrenphilosophicalscorchingonly childgrandchildmicrochip
Total 119, 30 Per page  4/4  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words