Sentencedict.com
 Directly to word page Vague search(google)
Home > Spermicide in a sentence

Spermicide in a sentence

  up(0)  down(0)
Sentence count:23Posted:2017-11-09Updated:2020-07-24
Similar words: germicidehomicideepidermicmicrobicidehomicidalgeothermicexothermicsuicideMeaning: n. a contraceptive agent that kills spermatozoa. 
Random good picture Not show
1. Although most condoms contain spermicide, there are some manufactured without.
2. Spermicides can cause an inflammation in some people and you should avoid their use if you do experience a reaction.
3. The spermicide didn't stay hostile to sperm for more than a few hours.
4. It contains no spermicide and is not a contraceptive.
5. Effectiveness: Fairly effective if used together with a spermicide .
6. For the most effective pregnancy protection, apply spermicide to the outside of the closed end of the condom before you place it in your vagina.
7. You could use spermicide in addition to pulling out just in case he doesn't pull out in time (then it will hopefully kill any of the sperm that make it in).
8. Use Condoms without spermicide for Birth control instead of Birth Control Pills. Use Natural Progesterone instead of HRT.
9. Spermicide isn't a highly effective birth control method when used alone.
10. Using a spermicide with condoms can offer better protection against pregnancy, but may not be right for everyone.
11. The VA is lubricated and does not contain spermicide . Oil-based lubricants should not be used with this female condom as they can damage latex.
12. Spermicide is available without a prescription and comes in many forms, including cream, gel, foam, film,(sentencedict.com) suppository and tablet.
13. All spermicide sold in the United States contains the chemical nonoxynol-9, which kills sperm.
14. If you need birth control only occasionally over-the-counter male or female condoms might be appropriate birth control options. You might also consider a contraceptive sponge and spermicide.
15. Many variables were considered including household income, race, condom and spermicide usage and number of partners, to name a few.
16. The study showed those women who frequently used condoms and/or spermicide in the past as well as those women who did not have one single partner were more likely to use the microbicide, if available.
17. But could slowing HIV be as simple as using an inexpensive spermicide?
18. Do not use birth control pills; use a condom without spermicide instead.
18. Wish you can benefit from our online sentence dictionary and make progress every day!
19. BACKGROUND AND AIM: study the feasibility of anti - semen antibody as spermicide.
20. Hand lotion, tampons, a diaphragm case, deodorant, lipstick, a bottle of multivitamins, atube of spermicide on the bottom shelf.
21. There is silicone-based lubricant on the inside of the condom, but additional lubrication can be used. The condom does not contain spermicide .
22. Take the practice of women in ancient Egypt, who resorted to using crocodile dung as a spermicide.
23. A small California biotech company, Epicyte, in 2001 announced the development of genetically engineered corn which contained a spermicide which made the semen of men who ate it sterile.
More similar words: germicidehomicideepidermicmicrobicidehomicidalgeothermicexothermicsuicideendothermichypothermicregicideherbicidefeticidepanspermiavermicellihypodermicvermicularparricidefungicideacaricidepesticidepatricidefratricideepidermisoligospermiainfanticideinsecticidecommit suicidetaxidermistbeats per minute
Total 23, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words