Sentencedict.com
 Directly to word page Vague search(google)
Home > Unhealthy in a sentence

Unhealthy in a sentence

  up(1)  down(4)
Sentence count:178+6Posted:2017-02-25Updated:2020-07-24
Synonym: ailingfeeblefrailillindisposedinfirmrun-downsicklyunsoundunwellunwholesomeweakSimilar words: healthywealthystealthyhealthhealthcarewealthstealthilycommonwealthMeaning: adj. 1. not in or exhibiting good health in body or mind 2. detrimental to health 3. not conducive to good health. 
Random good picture Not show
151. Although jerboas rarely appear on these owls' menus, for the 3-toed jerboa that's it, and then heads for home, not only to avoid any unhealthy attention, but also to avoid the chilly temperatures.
152. He also disapproved of all sexual activity as unhealthy. His own marriage remained unconsummated , and he considered masturbation especially harmful, calling it "the silent killer of the night".
153. A third argument is that inequality perverts politics, with Wall Street's influence in Washington often cited as exhibit A of the unhealthy clout of a plutocratic elite.
154. They binge and then go back to their unhealthy habits.
155. Time, bandwidth and memory resources are occupied to result in the link block as well as the deluge of unhealthy messages.
156. Conclusion The incidence of fatty liver has close relationship with high-fat and high-protein diet and unhealthy eating habit.
157. They looked pale and unhealthy, with unwashed hair and sunken cheeks.
158. According to Dr. Richard Guyer, president of the Texas Back Institute, crunches and sit-ups put an unhealthy strain on your back due to the flex movement of the crunch or sit-up.
159. Heaps of rubbish on the land make the environment unhealthy.
160. Rejecting Vice Admiral Halsey to his face was an unhealthy undertaking.
161. Obese people were also significantly more likely to be pictured from the side or rear, unclothed or in slovenly attire[sentencedict.com], eating unhealthy food and being lazy.
162. Where do we draw the line between normal, healthy, typical behavior and what we might want to call abnormal, atypical, deviant, unhealthy maladaptive mental problems?
163. We must eradicate the unhealthy tendency of cheating in exams.
164. And there are some who injure themselves through the unmeritorious deeds of hanging themselves, leaping from cliffs, eating poison and unhealthy foods.
165. Results We draw a conclusion that many women have unhealthy eating and sport habits.
166. You can't subject yourself to an unhealthy living arrangement just because someone's heart is in the right place.
167. Eating pork is not only unhealthy but also forbidden by divine law.
168. Greasy, downscale, industrialized, aggressively unhealthy,[http://sentencedict.com/unhealthy.html] McDonald's was a ripe target for popular-culture agitators.
169. Also, overweight children may be underreporting their intake of unhealthy food and may misperceive the quality of the exercise they do.
170. Strike a happy medium in your weight control; it's unhealthy to be only skin and bones.
171. The only truly unhealthy knee in the study belonged to a former marathoner, who had quit the sport.
172. There are some pet stores that buy their puppies from commercial kennels regulated by the Department of Agriculture. However, even these pups tend to be unhealthy and unsocialized.
173. Women are still the majority of the world's poor, unhealthy, underfed, and uneducated.
174. No matter what your current weight, being activeboosts high-density lipoprotein (HDL), or "good, " cholesterol anddecreases unhealthy triglycerides.
175. And only 30 percent of those who reported being told bytheir health care provider that their weight was unhealthy agreed with thatopinion, according to the study.
176. Refer to the lithiasis, many people think that it's caused by eating unhealthy food.
177. The Federal Trade Commission wants to curb the marketing of unhealthy food to children.
178. This paper deals with the reasons that cause the unhealthy psychology of the poor students by some methods such as theoretical analysis questionnaire investigation and mathematics statistics, etc.
More similar words: healthywealthystealthyhealthhealthcarewealthstealthilycommonwealthfilthypinheadmaidenheadalthoughdealtfealtyhealappeal tounhappyinheritinherentinheritorinherentlypithyworthyearthyapathylengthyempathywith youngallopathysympathy
Total 178, 30 Per page  6/6  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words